Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ GPBAR1 (Human) Recombinant Protein (P01)

Catalog No. 89968714 Shop All Abnova Corporation Products
Click to view available options
:
2 ug

Human Recombinant Protein

Human GPBAR1 full-length ORF ( AAH33625, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Specifications

Accession Number AAH33625
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Gene ID (Entrez) 151306
Name G protein-coupled bile acid receptor 1
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Source Wheat Germ (in vitro)
Storage Requirements Store at -80°C Aliquot to avoid repeated freezing and thawing
Gene Alias BG37,GPCR,GPCR19,GPR131,M-BAR,MGC40597,TGR5
Common Name GPBAR1
Recombinant Recombinant
Sequence MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Target Species Named Human
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.