Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180012
Description
GPBP Polyclonal specifically detects GPBP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GPBP | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
GC-rich promoter binding protein 1, MGC126339, SSH6, vascular wall-linked protein | |
Rabbit | |
Affinity purified | |
RUO | |
65056 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
NP_075064 | |
GPBP1 | |
Synthetic peptide directed towards the N terminal of human DKFZP761C169. Peptide sequence RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Rat: 92%; Bovine: 92%; Canine: 92%; Crab-eating macaque: 92%; Sumatran orangutan: 92%; Mouse: 92%; Chicken: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction