Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GPER/GPR30 Antibody, Novus Biologicals™

GPER/GPR30 Antibody, Novus Biologicals™
SDP

Catalog No. p-200048863 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB362515 25 μL
NB362516 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB362515 Supplier Novus Biologicals Supplier No. NBP32123825UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GPER/GPR30 Polyclonal antibody specifically detects GPER/GPR30 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen GPER/GPR30
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CEPRG-protein coupled receptor 30, Chemoattractant receptor-like 2, chemokine receptor-like 2, CMKRL2MGC99678, constitutively expressed peptide-like receptor, DRY12IL8-related receptor DRY12, FEG-1mER, Flow-induced endothelial G-protein coupled receptor 1, G protein-coupled estrogen receptor 1, G protein-coupled receptor 30, GPCR-BR, GPR30GPCR-Br, G-protein coupled estrogen receptor 1, heptahelix receptor, LERGU, LERGU2, leucine rich protein in GPR30 3'UTR, LyGPR, Lymphocyte-derived G-protein coupled receptor, Membrane estrogen receptor
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Purification Method Affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, GPCR, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 2852
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.