GPIHBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247445

Catalog No. NBP247445

Description

GPIHBP1 Polyclonal specifically detects GPIHBP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GPIHBP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: glycosylphosphatidylinositol anchored high density lipoprotein binding protein1, glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein1, GPI anchored high density lipoprotein binding protein 1, GPI-anchored HDL-binding protein 1, GPI-HBP1LOC338328, HBP1, High density lipoprotein-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GPIHBP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT
• Quantity: 0.1 mL
• Research Discipline: Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 338328
• Target Species: Human
• Isotype: IgG

For Research Use Only