Novus Biologicals™ GPR37 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR37. Source: E.coli Amino Acid Sequence: RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGA The GPR37 Recombinant Protein Antigen is derived from E. coli. The GPR37 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 2861
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: GPR37 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: EDNRBL, Endothelin B receptor-like protein 1, G protein-coupled receptor 37 (endothelin receptor type B-like), hET(B)R-LP, PAELRETBR-LP-1, Parkin-associated endothelin receptor-like receptor, probable G-protein coupled receptor 37
• Gene Symbol: GPR37
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: Human

For research use only.