Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPR88 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | GPR88 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18050820
|
Novus Biologicals
NBP18050820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP180508
|
Novus Biologicals
NBP180508 |
100 μL |
Each for $487.50
|
|
|||||
Description
GPR88 Polyclonal specifically detects GPR88 in Rat samples. It is validated for Western Blot.Specifications
| GPR88 | |
| Polyclonal | |
| Rabbit | |
| NP_113884 | |
| 54112 | |
| Synthetic peptide directed towards the C terminal of human Gpr88. Peptide sequence LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| G protein coupled receptor 88, G protein-coupled receptor 88, G-protein coupled receptor 88, probable G-protein coupled receptor 88, STRG, Striatum-specific G-protein coupled receptor | |
| GPR88 | |
| IgG | |
| 40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title