Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GPSM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159748 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159748 100 μg
NB159749 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB159748 Supplier Novus Biologicals Supplier No. NBP317859100UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

GPSM1 Polyclonal antibody specifically detects GPSM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen GPSM1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 1810037C22Rik, C. elegans), DKFZp727I051, G-protein signaling modulator 1, G-protein-signaling modulator 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Biology, Cell Cycle and Replication, GPCR, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 26086
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.