Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gr-1/Ly-6G Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309524100UL
Description
Gr-1/Ly-6G Polyclonal specifically detects Gr-1/Ly-6G in Human samples. It is validated for Western Blot.Specifications
Gr-1/Ly-6G | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C6orf23, G6D, LY6-D, LY6G6D, lymphocyte antigen 6 family member G6D, MEGT1, NG25 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Gr-1/Ly-6G (NP_067069). Peptide sequence LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT | |
100 μg | |
Innate Immunity | |
58530 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction