Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gr-1/Ly-6G Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309524100UL
Description
Gr-1/Ly-6G Polyclonal specifically detects Gr-1/Ly-6G in Human samples. It is validated for Western Blot.Specifications
Gr-1/Ly-6G | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C6orf23, G6D, LY6-D, LY6G6D, lymphocyte antigen 6 family member G6D, MEGT1, NG25 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Gr-1/Ly-6G (NP_067069). Peptide sequence LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT | |
100 μg | |
Innate Immunity | |
58530 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction