Granulysin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23883925UL

Catalog No. NB436081

Description

Granulysin Polyclonal specifically detects Granulysin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Granulysin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P22749
• Gene Symbols: GNLY
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP
• Quantity: 25 μL
• Research Discipline: Adaptive Immunity, Immunology
• Gene ID (Entrez): 10578
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: D2S69Elymphocyte-activation gene 2, granulysin, LAG2, LAG-2, Lymphokine LAG-2, NKG5519, Protein NKG5, TLA519T-cell activation protein 519, T-lymphocyte activation gene 519
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.