GRASP65 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247443

Catalog No. NBP247443

Description

GRASP65 Polyclonal specifically detects GRASP65 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GRASP65
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Golgi peripheral membrane protein p65, Golgi phosphoprotein 5MGC118897, golgi reassembly stacking protein 1, 65kDa, Golgi reassembly-stacking protein 1, Golgi reassembly-stacking protein of 65 kDa, GRASP65MGC118894, P6565 kDa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GORASP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
• Quantity: 0.1 mL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 64689
• Target Species: Human
• Isotype: IgG

For Research Use Only