Learn More
Description
Specifications
Specifications
| Antigen | GRASP65 |
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Golgi peripheral membrane protein p65, Golgi phosphoprotein 5MGC118897, golgi reassembly stacking protein 1, 65kDa, Golgi reassembly-stacking protein 1, Golgi reassembly-stacking protein of 65 kDa, GRASP65MGC118894, P6565 kDa |
| Gene Symbols | GORASP1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
