Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | GRB2 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GRB2 Polyclonal specifically detects GRB2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
GRB2 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Breast Cancer, Cancer, Extracellular Matrix, Signal Transduction | |
abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2 | |
GRB2 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
2885 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title