Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRINL1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257432
Description
GRINL1A Polyclonal specifically detects GRINL1A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
GRINL1A | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
DKFZp586F1918, glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A, Glutamate receptor-like protein 1A, GRINL1A downstream protein Gdown4, protein GRINL1A, protein GRINL1A, isoforms 4/5 | |
Rabbit | |
Affinity Purified | |
RUO | |
81488 | |
Human | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
POLR2M | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction