Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579330

Invitrogen™ GRK2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579330
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579330 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579330 Supplier Invitrogen™ Supplier No. PA579330
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, rat stomach tissue, mouse lung tissue, mouse liver tissue, mouse pancreas tissue. IHC: human Lung cancer tissue, mouse spleen tissue, rat spleen tissue. ICC/IF: U20S cell. Flow: U87 cell.

ADRBK1 (GRK2) is a serine/threonine kinase. Many of the G protein-coupled receptors are known to be phosphorylated by G protein-dependent receptor kinases (GRKs). G protein-coupled receptor kinases (GRKs) are important regulators of G protein-coupled receptors(GPCRs). GRK2 (83 kDa), one of six members of this family that have been identified, is ubiquitously expressed in mammals. After binding to their ligand and interacting with heterotrimeric G proteins, GPCRs (e.g., a2-adrenergic receptor) are phosphorylated by GRKs. Internalization of the GPCRs, regulated by beta-arrestin-1, leads to activation of the Ras - Raf - ERK1&2 signaling pathway. GRK2 activity is tightly controlled by different mechanisms including phosphorylation by kinases such as PKC, Src and ERK1&2, as well as interaction with various proteins. ERK phosphorylates and thus inactivates GRK2 on serine 670 in a negative feedback mechanism.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GRK2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene GRK2
Gene Accession No. P25098, P26817, Q99MK8
Gene Alias ADRBK1; Adrbk-1; adrenergic beta receptor kinase 1; adrenergic receptor kinase, beta 1; adrenergic, beta, receptor kinase 1; BARK; BARK1; Bark-1; beta ARK; Beta-adrenergic receptor kinase 1; beta-adrenergic receptor kinase 1 beta ARK1; beta-AR kinase-1; betaARK1; BETA-ARK1; beta-ARK-1; EC 2.7.1.126; G protein-coupled receptor kinase 2; G-protein coupled receptor kinase 2; G-protein-coupled receptor kinase 2; grk 2; Grk2; GRK-2
Gene Symbols GRK2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 110355, 156, 25238
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.