Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595301

Invitrogen™ GRK3 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595301
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595301 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595301 Supplier Invitrogen™ Supplier No. PA595301
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: JURKAT whole cell. ICC/IF: U20S cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

ADRBK2, or adrenergic beta receptor kinase 2 is a serine/threonine kinase that is thought to act as a regulator of receptor function. Overall, the ADRBK2 enzyme, also known as GRK3, has 85% amino acid similarity with ADRBK1, with the protein kinase catalytic domain having 95% similarity. The ADRBK2 mRNA is approximately 8 kilobases with a distribution similar to that of ADRBK1. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GRK3
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene GRK3
Gene Accession No. P35626
Gene Alias 4833444A01Rik; ADRBK2; Adrbk-2; adrenergic receptor kinase, beta 2; adrenergic receptor kinase, beta 2 (G-protein-linked receptor kinase); adrenergic, beta, receptor kinase 2; AI851927; AW551196; BARK2; Bark-2; beta ARK2; beta-adrenergic receptor kinase 2; Beta-ARK-2; G protein-coupled receptor kinase 3; G-protein-coupled receptor kinase 3; Grk3
Gene Symbols GRK3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 157
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.