Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579331

Invitrogen™ GRK5 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579331
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579331 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579331 Supplier Invitrogen™ Supplier No. PA579331
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human Hela whole cell, human A549 whole cell, rat heart tissue, mouse heart tissue. IHC: rat cardiac muscle tissue, mouse lung tissue, human placenta tissue.

GRK5 is a serine/threonine kinase that regulates the activity of a variety of G protein-coupled receptors and the motility of polymorphonuclear leukocytes. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GRK5
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene GRK5
Gene Accession No. P34947, Q62833, Q8VEB1
Gene Alias 1200003L19Rik; Alpha-CP4; AlphaCP-4; FP2025; G protein-coupled receptor kinase 5; G protein-coupled receptor kinase GRK5; Gprk5; GRK; Grk5; GRK5 protein kinase; GRK-pan; Pan-GRK; Pcbp4; poly(rC) binding protein 4; poly(rC)-binding protein 4
Gene Symbols GRK5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11476, 14773, 236300, 2869, 59075, 59092
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.