Growth Hormone R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169449

Catalog No. NBP169449

Description

Growth Hormone R Polyclonal specifically detects Growth Hormone R in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Growth Hormone R
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GH receptor, GHBP, growth hormone binding protein, growth hormone receptor, serum binding protein, Somatotropin receptor
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Signal Transduction
• Gene ID (Entrez): 2690
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P10912
• Gene Symbols: GHR
• Immunogen: Synthetic peptides corresponding to GHR(growth hormone receptor) The peptide sequence was selected from the N terminal of Growth hormone receptor. Peptide sequence LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only