Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRP78/HSPA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP189968
Description
GRP78/HSPA5 Polyclonal specifically detects GRP78/HSPA5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GRP78/HSPA5 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
78 kDa glucose-regulated protein, BiP, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, FLJ26106, GRP-78, GRP78BIP, Heat shock 70 kDa protein 5, heat shock 70kD protein 5 (glucose-regulated protein, 78kD), heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa), Immunoglobulin heavy chain-binding protein, MIF2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
HSPA5 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK | |
0.1 mL | |
Cancer, Cellular Markers, ER Markers, Lipid and Metabolism, Unfolded Protein Response | |
3309 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction