GRP78/HSPA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189968

Catalog No. NBP189968

Description

GRP78/HSPA5 Polyclonal specifically detects GRP78/HSPA5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GRP78/HSPA5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 78 kDa glucose-regulated protein, BiP, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, FLJ26106, GRP-78, GRP78BIP, Heat shock 70 kDa protein 5, heat shock 70kD protein 5 (glucose-regulated protein, 78kD), heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa), Immunoglobulin heavy chain-binding protein, MIF2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HSPA5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cellular Markers, ER Markers, Lipid and Metabolism, Unfolded Protein Response
• Gene ID (Entrez): 3309
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only