GSPT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191971

Catalog No. NBP191971

Description

GSPT2 Polyclonal specifically detects GSPT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GSPT2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: eRF3b, ERF3BGST2, eukaryotic peptide chain release factor GTP-binding subunit ERF3B, Eukaryotic peptide chain release factor subunit 3b, FLJ10441, G1 to S phase transition 2, G1 to S phase transition protein 2 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GSPT2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 23708
• Target Species: Human
• Isotype: IgG

For Research Use Only