GSTA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154817

Catalog No. NBP154817

Description

GSTA4 Polyclonal specifically detects GSTA4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GSTA4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686D21185, EC 2.5.1.18, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4, Glutathione S-transferase A4-4, glutathione S-transferase alpha 4, glutathione transferase A4-4, GST class-alpha member 4, GSTA4-4, GTA4, S-(hydroxyalkyl)glutathione lyase A4
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 2941
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: O15217
• Gene Symbols: GSTA4
• Immunogen: Synthetic peptides corresponding to GSTA4(glutathione S-transferase A4) The peptide sequence was selected from the C terminal of GSTA4. Peptide sequence LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.