GSTM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155103

Catalog No. NBP155103

Description

GSTM2 Polyclonal specifically detects GSTM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GSTM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: glutathione S-transferase mu 2 (muscle), MGC117303, muscle, S-(hydroxyalkyl)glutathione lyase M2
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 79%.
• Target Species: Human, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P28161
• Gene Symbols: GSTM2
• Immunogen: Synthetic peptides corresponding to GSTM2(glutathione S-transferase M2 (muscle)) The peptide sequence was selected from the N terminal of GSTM2. Peptide sequence TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2946
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only