Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GSTZ1 Antibody, Novus Biologicals™

GSTZ1 Antibody, Novus Biologicals™
SDP

Catalog No. p-7106658 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155137 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155137 Supplier Novus Biologicals Supplier No. NBP155137
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GSTZ1 Polyclonal specifically detects GSTZ1 in Human samples. It is validated for Western Blot.

Specifications

Antigen GSTZ1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O43708
Gene Alias EC 2.5.1.18, EC 5.2.1.2, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, Glutathione S-transferase zeta 1, glutathione transferase zeta 1, GSTZ1-1maleylacetoacetate isomerase, MAAIglutathione S-aryltransferase, MAI, maleylacetone isomerase, MGC2029, S-(hydroxyalkyl)glutathione lyase
Gene Symbols GSTZ1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF.
Molecular Weight of Antigen 24 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2954
Test Specificity Goat: 77%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.