GTF2A1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169205

Catalog No. NBP169205

Description

GTF2A1L Polyclonal specifically detects GTF2A1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GTF2A1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: GTF2A1L
• Immunogen: Synthetic peptides corresponding to GTF2A1L (general transcription factor IIA, 1-like) The peptide sequence was selected from the C terminal of GTF2A1L. Peptide sequence EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11036
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 1-like factor, general transcription factor IIA, 1-like, GTF2A1LF, MGC26254, TFIIA large subunit isoform ALF, TFIIA-alpha and beta-like factor, TFIIA-alpha/beta-like factor
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Equine: 86%; Mouse: 79%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine
• Isotype: IgG