Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GTF2H1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	GTF2H1
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB396766 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23855625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP238556 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238556	0.1 mL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GTF2H1 Polyclonal specifically detects GTF2H1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	GTF2H1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, DNA Repair, Nucleotide Excision Repair
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	Basic transcription factor 2 62 kDa subunit, BTF2 p62, BTF2general transcription factor IIH, polypeptide 1 (62kD subunit), General transcription factor IIH polypeptide 1, general transcription factor IIH subunit 1, general transcription factor IIH, polypeptide 1, 62kDa, TFB1, TFIIH, TFIIH basal transcription factor complex p62 subunit
Gene Symbols	GTF2H1
Isotype	IgG
Purification Method	Affinity Purified

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	P32780
Gene ID (Entrez)	2965
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GTF2H1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents