Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTF3C2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310918100UL
Description
GTF3C2 Polyclonal specifically detects GTF3C2 in Human samples. It is validated for Western Blot.Specifications
| GTF3C2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| general transcription factor 3C polypeptide 2, general transcription factor IIIC, polypeptide 2, beta 110kDa, KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD), TF3C-beta, TFIIIC 110 kDa subunit, TFIIIC110Transcription factor IIIC 110 kDa subunit, TFIIIC-BETA, Transcription factor IIIC subunit beta | |
| The immunogen is a synthetic peptide directed towards the middle region of human GTF3C2 (NP_001512). Peptide sequence YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2976 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction