Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GTF3C2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310918100UL

 View more versions of this product

Catalog No. NB126735


Add to cart

Description

Description

GTF3C2 Polyclonal specifically detects GTF3C2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GTF3C2
Unconjugated
PBS buffer, 2% sucrose
general transcription factor 3C polypeptide 2, general transcription factor IIIC, polypeptide 2, beta 110kDa, KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD), TF3C-beta, TFIIIC 110 kDa subunit, TFIIIC110Transcription factor IIIC 110 kDa subunit, TFIIIC-BETA, Transcription factor IIIC subunit beta
The immunogen is a synthetic peptide directed towards the middle region of human GTF3C2 (NP_001512). Peptide sequence YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
2976
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit