GTF3C5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25570725UL

Catalog No. NB394865

Description

GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GTF3C5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9328
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GTF3C5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only