Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTF3C5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GTF3C5 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
GTF3C5 | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Human | |
FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD | |
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF3C5 (NP_036219). Peptide sequence SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
9328 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title