Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTF3C5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | GTF3C5 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB125879
|
Novus Biologicals
NBP310489100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
GTF3C5 | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Human | |
FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD | |
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF3C5 (NP_036219). Peptide sequence SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
9328 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title