GTP binding protein era homolog Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP157433	100 μL

Catalog No. NBP157433 Supplier Novus Biologicals Supplier No. NBP157433

Description

Rabbit Polyclonal Antibody

GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GTP binding protein era homolog
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: O75616
• Gene Alias: CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B
• Gene Symbols: ERAL1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26284
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Bovine: 78%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG