Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTPBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | GTPBP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15764820
![]() |
Novus Biologicals
NBP15764820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157648
![]() |
Novus Biologicals
NBP157648 |
100 μL |
Each for $487.50
|
|
|||||
Description
GTPBP2 Polyclonal specifically detects GTPBP2 in Human samples. It is validated for Western Blot.Specifications
GTPBP2 | |
Polyclonal | |
Rabbit | |
Q9BX10 | |
54676 | |
Synthetic peptides corresponding to GTPBP2(GTP binding protein 2) The peptide sequence was selected from the N terminal of GTPBP2. Peptide sequence GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
GTP binding protein 2, GTP-binding protein 2, MGC74725 | |
GTPBP2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title