Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Guanylate kinase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP276521
Description
Guanylate kinase Polyclonal specifically detects Guanylate kinase in Human samples. It is validated for Western Blot.Specifications
Guanylate kinase | |
Polyclonal | |
Western Blot 0.4 μ/mL | |
EC 2.7.4.8, FLJ42686, FLJ43710, GMK, GMP kinase, guanylate kinase, guanylate kinase 1 | |
Rabbit | |
100 μL | |
2987 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
GUK1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction