Guanylyl Cyclase beta 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP158869

Catalog No. NBP158869

Description

Guanylyl Cyclase beta 1 Polyclonal specifically detects Guanylyl Cyclase beta 1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Guanylyl Cyclase beta 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 71 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta-1.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q02153
• Gene Symbols: GUCY1B3
• Immunogen: Synthetic peptides corresponding to GUCY1B3(guanylate cyclase 1, soluble, beta 3) The peptide sequence was selected from the N terminal of GUCY1B3 (NP_000848). Peptide sequence LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2983
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only