Learn More
Invitrogen™ H-Ras Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA594930
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, HEPA whole cell. IHC: mouse intestine tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Monomeric G protein Ras functions as a molecular switch linking receptor and nonreceptor tyrosine kinase activation to a number of downstream signaling pathways leading to distinct cytoplasmic or nuclear events. Each mammalian cell contains three Ras proto-oncogene coding for closely related Ras proteins: H-, K-, N-Ras. Oncogenic mutations in Ras genes are present in ~30% of all human cancers. Constitutive activation of Ras due to mutations or overexpression stimulates proliferation and inhibition of apoptosis. K-Ras mutations are common in pancreatic, colorectal and nonsmall-cell lung carcinomas; H-Ras mutations are common in bladder, kidney and thyroid carcinomas; N-Ras mutations are found in melanoma, hematological malignancies and hepatocellular carcinaoma.
Specifications
H-Ras | |
Polyclonal | |
Unconjugated | |
HRAS | |
C-BAS/HAS; c-Ha-ras; c-Ha-ras p21 protein; c-Ha-ras transgene; C-HA-RAS1; c-has/bas p21 protein; c-H-ras; c-rasHa; c-ras-Ki-2 activated oncogene; CTLO; GTP- and GDP-binding peptide B; GTPase HRas; GTPase HRas, N-terminally processed; GTPase Hras1; HAMSV; Ha-ras; Ha-Ras1 proto-oncoprotein; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; Harvey rat sarcoma virus oncogene; Harvey rat sarcoma virus oncogene 1; Harvey-ras; Hras; H-ras; H-ras 1 protein; HRas proto-oncogene, GTPase; HRAS1; H-Ras-1; Hras-1; H-RASIDX; Kras2; p19 H-RasIDX protein; p21ras; ras; Ras family small GTP binding protein H-Ras; ras p21; RASH1; transformation gene: oncogene HAMSV; transforming protein P21; v-Ha-ras Harvey rat sarcoma viral oncogene homolog | |
Rabbit | |
Affinity chromatography | |
RUO | |
15461, 293621, 3265 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P01112, P20171, Q61411 | |
HRAS | |
A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.