Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ H-Ras Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA594930

Catalog No. PIPA594930


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, HEPA whole cell. IHC: mouse intestine tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Monomeric G protein Ras functions as a molecular switch linking receptor and nonreceptor tyrosine kinase activation to a number of downstream signaling pathways leading to distinct cytoplasmic or nuclear events. Each mammalian cell contains three Ras proto-oncogene coding for closely related Ras proteins: H-, K-, N-Ras. Oncogenic mutations in Ras genes are present in ~30% of all human cancers. Constitutive activation of Ras due to mutations or overexpression stimulates proliferation and inhibition of apoptosis. K-Ras mutations are common in pancreatic, colorectal and nonsmall-cell lung carcinomas; H-Ras mutations are common in bladder, kidney and thyroid carcinomas; N-Ras mutations are found in melanoma, hematological malignancies and hepatocellular carcinaoma.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

H-Ras
Polyclonal
Unconjugated
HRAS
C-BAS/HAS; c-Ha-ras; c-Ha-ras p21 protein; c-Ha-ras transgene; C-HA-RAS1; c-has/bas p21 protein; c-H-ras; c-rasHa; c-ras-Ki-2 activated oncogene; CTLO; GTP- and GDP-binding peptide B; GTPase HRas; GTPase HRas, N-terminally processed; GTPase Hras1; HAMSV; Ha-ras; Ha-Ras1 proto-oncoprotein; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; Harvey rat sarcoma virus oncogene; Harvey rat sarcoma virus oncogene 1; Harvey-ras; Hras; H-ras; H-ras 1 protein; HRas proto-oncogene, GTPase; HRAS1; H-Ras-1; Hras-1; H-RASIDX; Kras2; p19 H-RasIDX protein; p21ras; ras; Ras family small GTP binding protein H-Ras; ras p21; RASH1; transformation gene: oncogene HAMSV; transforming protein P21; v-Ha-ras Harvey rat sarcoma viral oncogene homolog
Rabbit
Affinity chromatography
RUO
15461, 293621, 3265
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
P01112, P20171, Q61411
HRAS
A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.