Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP254988PE

Novus Biologicals™ HADHA Recombinant Protein Antigen
SDP

Catalog No. NBP254988PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254988PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP254988PE Supplier Novus Biologicals™ Supplier No. NBP254988PEP
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HADHA. Source: E.coli Amino Acid Sequence: DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK The HADHA Recombinant Protein Antigen is derived from E. coli. The HADHA Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Purity Greater than 80% by SDS-PAGE and Coomassie blue staining
Common Name HADHA Recombinant Protein Antigen
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application) Antibody Competition
Molecular Weight (g/mol) 28 kDa
Product Type Recombinant Protein Antigen
Quantity 100 μL
Sequence DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK
Source E. coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50314. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.