Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15316420UL
Description
HAO2 Polyclonal specifically detects HAO2 in Human samples. It is validated for Western Blot.Specifications
HAO2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NYQ3 | |
HAO2 | |
Synthetic peptides corresponding to HAO2(hydroxyacid oxidase 2 (long chain)) The peptide sequence was selected from the N terminal of HAO2. Peptide sequence DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
(S)-2-hydroxy-acid oxidase, peroxisomal, Cell growth-inhibiting gene 16 protein, EC 1.1.3.15, GIG16, growth-inhibiting protein 16, HAOX2glycolate oxidase, hydroxyacid oxidase 2, hydroxyacid oxidase 2 (long chain), Long chain alpha-hydroxy acid oxidase, Long-chain L-2-hydroxy acid oxidase | |
Rabbit | |
Affinity Purified | |
RUO | |
51179 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction