Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HARS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18949025UL
Description
HARS Polyclonal specifically detects HARS in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
HARS | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
cytoplasmic, EC 6.1.1.21, FLJ20491, histidine-tRNA ligase, histidyl-tRNA synthetase, histidyl-tRNA synthetase, cytoplasmic | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human HARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
HARS | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD | |
25 μL | |
Proteases & Other Enzymes | |
3035 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction