HAUS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179780

Catalog No. NBP179780

Description

HAUS8 Polyclonal specifically detects HAUS8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HAUS8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DGT4, HAUS Augmin Like Complex Subunit 8, HEC1/NDC80 interacting, centrosome associated 1, HEC1/NDC80-Interacting Centrosome-Associated Protein 1, Hec1-Interacting And Centrosome-Associated 1, HICE1, NY-SAR-48, Sarcoma Antigen NY-SAR-48
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 92%.
• Target Species: Human, Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_219485
• Gene Symbols: HAUS8
• Immunogen: Synthetic peptide directed towards the N terminal of human HAUS8. Peptide sequence QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93323
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.