Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HAUS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
HAUS8 Polyclonal specifically detects HAUS8 in Human samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
93323 | |
Synthetic peptide directed towards the N terminal of human HAUS8. Peptide sequence QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA. | |
Primary |
Polyclonal | |
Rabbit | |
NP_219485 | |
HAUS8 | |
IgG | |
45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title