HBG1/2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198291

Catalog No. NBP198291

Description

HBG1/2 Polyclonal specifically detects HBG1/2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Hemoglobin gamma-2 chain
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hemoglobin subunit gamma-2, hemoglobin, gamma G, TNCY
• Host Species: Rabbit
• Molecular Weight of Antigen: 147 kDa
• Quantity: 100 μL
• Research Discipline: Cardiovascular Biology
• Gene ID (Entrez): 3048
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_000175
• Gene Symbols: HBG2
• Immunogen: The immunogen for this antibody is Hemoglobin gamma-2 chain - middle region. Peptide sequence MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Pig: 93%; Rat: 83%; Mouse: 83%; Dog: 77%; Horse: 77%; Guinea pig: 77%; Rabbit: 75%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep
• Isotype: IgG

For Research Use Only