Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP192161

HBO1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP192161 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP192161 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP192161 Supplier Novus Biologicals Supplier No. NBP192161
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HBO1 Polyclonal specifically detects HBO1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen HBO1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O95251
Gene Alias HBO1EC 2.3.1.48, HBOA, Histone acetyltransferase binding to ORC1, histone acetyltransferase MYST2, KAT7, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2, MYST histone acetyltransferase 2, MYST-2
Gene Symbols KAT7
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GCNSLGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNM
Molecular Weight of Antigen 76 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 11143
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.