HCAP-G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418246	Novus Biologicals NBP18819925UL	25 μL
NBP188199	Novus Biologicals NBP188199	0.1 mL

Description

HCAP-G Polyclonal specifically detects HCAP-G in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HCAP-G
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CAP-G, CAPGHCAP-G, CHCG, chromosome condensation protein G, Chromosome-associated protein G, condensin complex subunit 3, Condensin subunit CAP-G, FLJ12450, hCAP-G, Melanoma antigen NY-MEL-3, MGC126525, Non-SMC condensin I complex subunit G, non-SMC condensin I complex, subunit G, NYMEL3, NY-MEL-3, XCAP-G homolog
• Gene Symbols: NCAPG
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication, Cytoskeleton Markers, DNA Repair
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 64151
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only