Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HCFC1R1 Antibody, Novus Biologicals™

HCFC1R1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15307020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15307020 20 μL
NBP153070 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15307020 Supplier Novus Biologicals Supplier No. NBP15307020UL

Description

Rabbit Polyclonal Antibody

HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.

Specifications

Antigen HCFC1R1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NWW0
Gene Alias FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711
Gene Symbols HCFC1R1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM.
Molecular Weight of Antigen 15 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54985
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.