Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HCFC1R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15307020UL
Description
HCFC1R1 Polyclonal specifically detects HCFC1R1 in Human samples. It is validated for Western Blot.Specifications
HCFC1R1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NWW0 | |
HCFC1R1 | |
Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM. | |
Affinity Purified | |
RUO | |
54985 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711 | |
Rabbit | |
15 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction