HDDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156806

Catalog No. NBP156806

Description

HDDC3 Polyclonal specifically detects HDDC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HDDC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: HDDC3
• Immunogen: Synthetic peptides corresponding to HDDC3(HD domain containing 3) The peptide sequence was selected from the middle region of HDDC3. Peptide sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI.
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 374659
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: (ppGpp)ase, EC 3.1.7.2, guanosine-3'-5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD domain containing 3, HD domain-containing protein 3, MESH1, Metazoan SpoT homolog 1, metazoan SpoT homolog-1, MGC45386, Penta-phosphate guanosine-3'-pyrophosphohydrolase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Pig: 100%; Zebrafish: 100%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG