HDHD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18670725UL

Catalog No. NB431760

Description

HDHD3 Polyclonal specifically detects HDHD3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HDHD3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: C9orf158, chromosome 9 open reading frame 158,2810435D12Rik, haloacid dehalogenase-like hydrolase domain containing 3, haloacid dehalogenase-like hydrolase domain-containing protein 3, MGC12904
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HDHD3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 81932
• Target Species: Human
• Isotype: IgG

For Research Use Only