Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HECA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	HECA
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1581320 View Documents View Product Certificates	Novus Biologicals NBP15811320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP158113 View Documents View Product Certificates	Novus Biologicals NBP158113	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HECA Polyclonal specifically detects HECA in Human samples. It is validated for Western Blot.

Specifications

Antigen	HECA
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	dJ225E12.1, HDCHHDC, HDCL, headcase homolog (Drosophila), headcase protein homolog, hHDC
Gene Symbols	HECA
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9UBI9
Gene ID (Entrez)	51696
Immunogen	Synthetic peptides corresponding to HECA(headcase homolog (Drosophila)) The peptide sequence was selected from the middle region of HECA. Peptide sequence HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HECA Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents