Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEL-206 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C12orf40 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HEL-206 Polyclonal specifically detects HEL-206 in Human samples. It is validated for Western Blot.Specifications
C12orf40 | |
Polyclonal | |
Rabbit | |
Q86WS4 | |
283461 | |
Synthetic peptides corresponding to C12ORF40 The peptide sequence was selected from the N terminal of C12ORF40. Peptide sequence ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 12 open reading frame 40, FLJ40126, hypothetical protein LOC283461 | |
C12ORF40 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title