Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HEM1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HEM1 Polyclonal specifically detects HEM1 in Human samples. It is validated for Western Blot.Specifications
HEM1 | |
Polyclonal | |
Rabbit | |
NP_005328 | |
3071 | |
Synthetic peptide directed towards the N terminal of human NCKAP1L. Peptide sequence CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Hematopoietic protein 1HEM1Membrane-associated protein HEM-1, NCK-associated protein 1-like | |
NCKAP1L | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title