Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HEM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179230
|
Novus Biologicals
NBP179230 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HEM1 Polyclonal specifically detects HEM1 in Human samples. It is validated for Western Blot.Specifications
| HEM1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Hematopoietic protein 1HEM1Membrane-associated protein HEM-1, NCK-associated protein 1-like | |
| NCKAP1L | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_005328 | |
| 3071 | |
| Synthetic peptide directed towards the N terminal of human NCKAP1L. Peptide sequence CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title