Hematopoietic Prostaglandin D Synthase/HPGDS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154625

Catalog No. NBP154625

Description

Hematopoietic Prostaglandin D Synthase/HPGDS Polyclonal specifically detects Hematopoietic Prostaglandin D Synthase/HPGDS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hematopoietic Prostaglandin D Synthase/HPGDS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.5.1.18, EC 5.3.99.2, Glutathione S-transferase, glutathione S-transferase sigma, Glutathione-dependent PGD synthase, Glutathione-requiring prostaglandin D synthase, GST class-sigma, GSTShematopoietic prostaglandin D2 synthase, hematopoietic prostaglandin D synthase, H-PGDS, PGDSglutathione-dependent PGD synthetase, Prostaglandin-H2 D-isomerase, PTGDS2
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 27306
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O60760
• Gene Symbols: HPGDS
• Immunogen: Synthetic peptides corresponding to PGDS(prostaglandin D2 synthase, hematopoietic) The peptide sequence was selected from the N terminal of PGDS. Peptide sequence EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only