Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEMK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | HEMK2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HEMK2 Polyclonal specifically detects HEMK2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HEMK2 | |
Polyclonal | |
Rabbit | |
DNA replication Transcription Translation and Splicing | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
29104 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-methyltransferase, PRED28 | |
N6AMT1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title