Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HEPACAM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
Antigen | HEPACAM2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19158820
![]() |
Novus Biologicals
NBP19158820UL |
20 μL |
Each for $158.00
|
|
|||||
NBP191588
![]() |
Novus Biologicals
NBP191588 |
100 μL |
Each for $499.50
|
|
|||||
Description
HEPACAM2 Polyclonal specifically detects HEPACAM2 in Human samples. It is validated for Western Blot.Specifications
HEPACAM2 | |
Polyclonal | |
Rabbit | |
NP_001034461 | |
253012 | |
Synthetic peptide directed towards the middle region of human LOC253012. Peptide sequence NYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HEPACAM family member 2, MIKI | |
HEPACAM2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title