Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Polyclonal specifically detects Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 | |
Polyclonal | |
Rabbit | |
Human | |
9653 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986 | |
HS2ST1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title